PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049482
Common NameLOC102586087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28585.2 Da    PI: 9.8756
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049482genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.13.7e-312574150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey+
  PGSC0003DMP400049482 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYA 74
                          79***********************************************8 PP

2K-box1171.7e-38921893100
                 K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                           +s++ s++ea+a+++qqe++kL+++i nLq+++R++lGe+L+s++ keL++Leq++ek+++kiRskKnell+++ie++qk+e +l+++n
  PGSC0003DMP400049482  92 SSNTGSVSEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLGSMNSKELKSLEQKIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNN 180
                           3445559********************************************************************************** PP

                 K-box  92 kaLrkklee 100
                           ++Lr+k++e
  PGSC0003DMP400049482 181 QYLRAKIAE 189
                           ******986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.5011777IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-401776IPR002100Transcription factor, MADS-box
CDDcd002652.82E-451894No hitNo description
SuperFamilySSF554555.36E-331890IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-331939IPR002100Transcription factor, MADS-box
PfamPF003191.0E-262673IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-335475IPR002100Transcription factor, MADS-box
PfamPF014864.6E-28101187IPR002487Transcription factor, K-box
PROSITE profilePS5129715.112103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSVSE ANAQYYQQEA SKLRAQIGNL  120
QNQNRNMLGE SLGSMNSKEL KSLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KREVDLHNNN  180
QYLRAKIAET ERAQHQHQQM NLMPGSSSSY HELVPPPQQF DTRNYLQVNG LQTNNHYPRQ  240
DQPPIQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-201785169Myocyte-specific enhancer factor 2B
1tqe_Q1e-201785169Myocyte-specific enhancer factor 2B
1tqe_R1e-201785169Myocyte-specific enhancer factor 2B
1tqe_S1e-201785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankTOMTAG1A0.0L26295.1 Lycopersicon esculentum TAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358067.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X2
SwissprotQ401681e-180AG_SOLLC; Floral homeotic protein AGAMOUS
TrEMBLM1CRK70.0M1CRK7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000731340.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-124MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]